PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015881407.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family GRAS
Protein Properties Length: 806aa    MW: 86874.2 Da    PI: 6.5408
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015881407.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS321.71.5e-984458053374
            GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                     ++L ++Ae v +g+++ aq +Larl+++ sp g+p++R+a+yf+eAL+  l+   ++ + + pp++ ++ +++ ++ a+k+fsevsP+++f ++t
  XP_015881407.1 445 DQLDKAAELVGTGNFSHAQGILARLNHQLSPVGKPLHRAAFYFKEALQLLLLL--NNPVTSPPPRTPTPFDVIFKMGAYKVFSEVSPLIQFVNFT 537
                     78999*********************************************998..4445557888888999************************ PP

            GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledl..e 190
                     +Nqa+leav+ ++r+Hi+Dfdi+ G+QW++++q+L  R++g+psl+iT+++sp++++  el  ++e+L++fA+e+g++fe +v   + le+   +
  XP_015881407.1 538 CNQALLEAVDDANRIHIVDFDIGFGAQWASFMQELPLRNRGTPSLKITAFASPSTHHPVELGLMKENLTQFANEIGISFELEVCNFDILEQTsyT 632
                     **********************************************************************************9755544444226 PP

            GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl.eaklpreseerik 284
                     l+ ++++++Ea+aVn+ +   +   ++++l++    +L+++k+lsP++vv  ++ +d+ + +F +++l+al+ y  l++sl ++++   s++ +k
  XP_015881407.1 633 LSVFQTNENEAVAVNFPIWSSSS--QPAALPN----LLRFIKQLSPRIVVSLDRGCDRFDLPFPQHILQALQSYIILLESLdAVNV--PSDALNK 719
                     67778888********9955444..6888888....*********************************************55555..678899* PP

            GRAS 285 vErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     +Er+ll+++i++ v  + ++      ++  W+  + +aGF+p+++s+++++qa++++++++ +g++ve++++slvl+W++r+L+s+SaWr
  XP_015881407.1 720 IERFLLQPSIESTVLGRLRA----PDKMPLWKTLFASAGFTPLTFSNFTETQAECVVKRTPARGFHVEKRQASLVLYWQRRELISASAWR 805
                     ***************99998....999**************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.059417785IPR005202Transcription factor GRAS
PfamPF035145.1E-96445805IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 806 aa     Download sequence    Send to blast
MRGMPFHWQQ GKGVLEIAAA AAAAAAEAGG FPSICAGDKW KKQELCSFAT NEPTSVLHMR  60
RSPSPPTSAS TLSSSFGGGG GGGGVGGGDG GSTDNTGGVA AGLPPHTPAA PVTEPSTGAS  120
RKNEWASELQ PIPSGLEAVT GSGGERCGLG LEDWETMLSE TAASPGQDQS LLRWIAGDVD  180
DPSFCLKQLL QGGNNPLEFD GNAGLGVVDQ GTGFDHIGGA LGGVSGTGSL MAGINPNLGF  240
PGSGSANNNN NGSGKIGSIA PSSSGGLNYK VTNIGLGSNN NGNCNMQNPI LSNSAFGLPL  300
SVSLPPGMVY QPQQQDFESP DEKPQILNPQ LLMNQQQQPH LPQNPNFFLP LEQHLLQPQP  360
KRHNSGGVDP GSQISKVPFP DPGHEFMLRK QQQHLGFPQG MQFLPQHHHQ RKPLMVPKQK  420
MVGPSEELAA HQHQHHQQQQ HALLDQLDKA AELVGTGNFS HAQGILARLN HQLSPVGKPL  480
HRAAFYFKEA LQLLLLLNNP VTSPPPRTPT PFDVIFKMGA YKVFSEVSPL IQFVNFTCNQ  540
ALLEAVDDAN RIHIVDFDIG FGAQWASFMQ ELPLRNRGTP SLKITAFASP STHHPVELGL  600
MKENLTQFAN EIGISFELEV CNFDILEQTS YTLSVFQTNE NEAVAVNFPI WSSSSQPAAL  660
PNLLRFIKQL SPRIVVSLDR GCDRFDLPFP QHILQALQSY IILLESLDAV NVPSDALNKI  720
ERFLLQPSIE STVLGRLRAP DKMPLWKTLF ASAGFTPLTF SNFTETQAEC VVKRTPARGF  780
HVEKRQASLV LYWQRRELIS ASAWRC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-3146280522375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015881407.10.0PREDICTED: scarecrow-like protein 22
TrEMBLM5WE330.0M5WE33_PRUPE; Uncharacterized protein
STRINGPOPTR_0003s11020.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF132692130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-118GRAS family protein